PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00151241001
Common NameGSBRNA2T00151241001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 242aa    MW: 26416.9 Da    PI: 5.4964
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00151241001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.72.2e-372581662
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++++
  GSBRNA2T00151241001 25 PSCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRTK 81
                         58***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-232174IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.632579IPR003851Zinc finger, Dof-type
PfamPF027011.7E-312679IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MERTEALTSS FIWRPNANAN AEITPSCPRC GSSNTKFCYY NNYSLTQPRY FCKGCRRYWT  60
KGGSLRNVPV GGGCRKSRRT KSSSSNAKTG VTASSCNSGG GSPNIDLALV YANFLNPKPD  120
EPTLRETCDL ATGASMEPSN WSIDIGDDHH HHHYDHQVEH IIEECGYNGL PPFPGEELLS  180
IDTNSVWSDA LLIGHNNHIE VGGVTSAETV HEPVVNFADE SNDSTNFLFG SWSPFDFSTD  240
G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.109580.0microspore-derived embryo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00151241001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136677.10.0PREDICTED: dof zinc finger protein DOF3.5-like
SwissprotQ9SVC51e-141DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A078DNQ00.0A0A078DNQ0_BRANA; BnaA03g41790D protein
TrEMBLM4D8J40.0M4D8J4_BRARP; Uncharacterized protein
STRINGBra012804.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-122Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]